GLYCTK (NM_145262) Human Recombinant Protein

CAT#: TP308348

Recombinant protein of human glycerate kinase (GLYCTK), transcript variant 1

Product Images

Coomassie blue staining of purified GLYCTK protein (Cat# TP308348). The protein was produced from HEK293T cells transfected with GLYCTK cDNA clone (Cat# RC208348) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208348 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAALQVLPRLARAPLHPLLWRGSVARLASSMALAEQARQLFESAVGAVLPGPMLHRALSLDPGGRQLKV
  RDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAMERAGKQEMLLKPHSRVQVFE
  GAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQ
  ELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAAL
  PRSVKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGL
  LAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRG
  GRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSH
  TFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 55.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_660305
• Locus ID: 132158
• UniProt ID: Q8IVS8, A1LQE8
• Cytogenetics: 3p21.2
• Refseq Size: 3798
• Refseq ORF: 1569
• Synonyms: HBeAgBP4A; HBEBP2; HBEBP4
• Summary: This locus encodes a member of the glycerate kinase type-2 family. The encoded enzyme catalyzes the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. Decreased activity of the encoded enzyme may be associated with the disease D-glyceric aciduria. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
• Protein Families: Transcription Factors
• Protein Pathways: Glycerolipid metabolism, Glycine, serine and threonine metabolism, Glyoxylate and dicarboxylate metabolism, Metabolic pathways