QPCT (NM_012413) Human Mass Spec Standard

CAT#: PH308388

QPCT MS Standard C13 and N15-labeled recombinant protein (NP_036545)

Product Images

Coomassie blue staining of purified QPCT protein (Cat# TP308388). The protein was produced from HEK293T cells transfected with QPCT cDNA clone (Cat# RC208388) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208388
• Predicted MW: 40.9 kDa
• Protein Sequence:
  Sequence Link

  >RC208388 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDL
  QPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACH
  YDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQ
  DSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHE
  LGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKI
  LQVFVLEYLHL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036545
• RefSeq Size: 1719
• RefSeq ORF: 1083
• Synonyms: GCT; QC; sQC
• Locus ID: 25797
• UniProt ID: Q16769
• Cytogenetics: 2p22.2
• Summary: This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq, Jul 2008]
• Protein Families: Protease