ACBD3 (NM_022735) Human Mass Spec Standard

CAT#: PH308434

ACBD3 MS Standard C13 and N15-labeled recombinant protein (NP_073572)

Product Images

Coomassie blue staining of purified ACBD3 protein (Cat# TP308434). The protein was produced from HEK293T cells transfected with ACBD3 cDNA clone (Cat# RC208434) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208434
• Predicted MW: 60.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208434 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAE
  EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGN
  DRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKE
  EEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL
  QEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELE
  PEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF
  ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEE
  VYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_073572
• RefSeq Size: 3581
• RefSeq ORF: 1584
• Synonyms: GCP60; GOCAP1; GOLPH1; PAP7
• Locus ID: 64746
• UniProt ID: Q9H3P7, A0A024R3P9
• Cytogenetics: 1q42.12
• Summary: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome