DHFRL1 (DHFR2) (NM_176815) Human Mass Spec Standard
CAT#: PH308452
DHFRL1 MS Standard C13 and N15-labeled recombinant protein (NP_789785)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208452 |
Predicted MW | 21.6 kDa |
Protein Sequence |
>RC208452 protein sequence
Red=Cloning site Green=Tags(s) MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_789785 |
RefSeq Size | 3934 |
RefSeq ORF | 561 |
Synonyms | DHFRL1; DHFRP4 |
Locus ID | 200895 |
UniProt ID | Q86XF0 |
Cytogenetics | 3q11.2 |
Summary | Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR. [UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406051 | DHFRL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406051 | Transient overexpression lysate of dihydrofolate reductase-like 1 (DHFRL1) |
USD 325.00 |
|
TP308452 | Recombinant protein of human dihydrofolate reductase-like 1 (DHFRL1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review