DHFRL1 (DHFR2) (NM_176815) Human Recombinant Protein

CAT#: TP308452

Recombinant protein of human dihydrofolate reductase-like 1 (DHFRL1)

Product Images

Coomassie blue staining of purified DHFR2 protein (Cat# TP308452). The protein was produced from HEK293T cells transfected with DHFR2 cDNA clone (Cat# RC208452) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208452 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD
  RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM
  QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_789785
• Locus ID: 200895
• UniProt ID: Q86XF0
• Cytogenetics: 3q11.2
• Refseq Size: 3934
• Refseq ORF: 561
• Synonyms: DHFRL1; DHFRP4
• Summary: Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome