PFDN3 (VBP1) (NM_003372) Human Mass Spec Standard

CAT#: PH308482

VBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003363)

Product Images

Coomassie blue staining of purified VBP1 protein (Cat# TP308482). The protein was produced from HEK293T cells transfected with VBP1 cDNA clone (Cat# RC208482) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208482
• Predicted MW: 22.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208482 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQK
  KRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEA
  QALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003363
• RefSeq Size: 1643
• RefSeq ORF: 591
• Synonyms: HIBBJ46; PFD3; PFDN3; VBP-1
• Locus ID: 7411
• UniProt ID: P61758
• Cytogenetics: Xq28
• Summary: The protein encoded by this gene interacts with the Von Hippel-Lindau protein to form an intracellular complex. The encoded protein functions as a chaperone protein, and may play a role in the transport of the Von Hippel-Lindau protein from the perinuclear granules to the nucleus or cytoplasm. Alternative splicing and the use of alternate transcription start sites results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Jan 2015]
• Protein Families: Druggable Genome