MAPKAP Kinase 2 (MAPKAPK2) (NM_032960) Human Mass Spec Standard
CAT#: PH308563
MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_116584)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208563 |
Predicted MW | 45.4 kDa |
Protein Sequence |
>RC208563 representing NM_032960
Red=Cloning site Green=Tags(s) MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVL GLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMEC LDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGF AKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIR MGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWE DVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_116584 |
RefSeq Size | 3071 |
RefSeq ORF | 1200 |
Synonyms | MAPKAP-K2; MK-2; MK2 |
Locus ID | 9261 |
UniProt ID | P49137 |
Cytogenetics | 1q32.1 |
Summary | This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | MAPK signaling pathway, Neurotrophin signaling pathway, VEGF signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409844 | MAPKAPK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417772 | MAPKAPK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409844 | Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2 |
USD 396.00 |
|
LY417772 | Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1 |
USD 396.00 |
|
PH320487 | MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_004750) |
USD 2,055.00 |
|
TP308563 | Recombinant protein of human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2 |
USD 823.00 |
|
TP320487 | Recombinant protein of human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review