MAPKAP Kinase 2 (MAPKAPK2) (NM_004759) Human Mass Spec Standard

CAT#: PH320487

MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_004750)

Product Images

Coomassie blue staining of purified MAPKAPK2 protein (Cat# TP320487). The protein was produced from HEK293T cells transfected with MAPKAPK2 cDNA clone (Cat# RC220487) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220487
• Predicted MW: 42 kDa
• Protein Sequence:
  Sequence Link

  >RC220487 representing NM_004759
  Red=Cloning site Green=Tags(s)
  
  MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVL
  GLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMEC
  LDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGF
  AKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIR
  MGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWE
  DVKGCLHDKNSDQATWLTRL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004750
• RefSeq Size: 3608
• RefSeq ORF: 1110
• Synonyms: MAPKAP-K2; MK-2; MK2
• Locus ID: 9261
• UniProt ID: P49137
• Cytogenetics: 1q32.1
• Summary: This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: MAPK signaling pathway, Neurotrophin signaling pathway, VEGF signaling pathway