GNG7 (NM_052847) Human Mass Spec Standard

CAT#: PH308768

GNG7 MS Standard C13 and N15-labeled recombinant protein (NP_443079)

Product Images

Coomassie blue staining of purified GNG7 protein (Cat# TP308768). The protein was produced from HEK293T cells transfected with GNG7 cDNA clone (Cat# RC208768) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208768
• Predicted MW: 7.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208768 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443079
• RefSeq Size: 4264
• RefSeq ORF: 204
• Synonyms: FLJ00058
• Locus ID: 2788
• UniProt ID: O60262
• Cytogenetics: 19p13.3
• Summary: ''
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway