CSP (DNAJC5) (NM_025219) Human Mass Spec Standard
CAT#: PH308826
DNAJC5 MS Standard C13 and N15-labeled recombinant protein (NP_079495)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208826 |
Predicted MW | 22 kDa |
Protein Sequence |
>RC208826 representing NM_025219
Red=Cloning site Green=Tags(s) MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKA PEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079495 |
RefSeq Size | 3286 |
RefSeq ORF | 594 |
Synonyms | CLN4; CLN4B; CSP; DNAJC5A; mir-941-2; mir-941-3; mir-941-4; mir-941-5; NCL |
Locus ID | 80331 |
UniProt ID | Q9H3Z4, Q6AHX3 |
Cytogenetics | 20q13.33 |
Summary | This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. The encoded protein plays a role in membrane trafficking and protein folding, and has been shown to have anti-neurodegenerative properties. The encoded protein is known to play a role in cystic fibrosis and Huntington's disease. A pseudogene of this gene is located on the short arm of chromosome 8. [provided by RefSeq, Nov 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410833 | DNAJC5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410833 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) |
USD 325.00 |
|
TP308826 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review