ANGPTL3 (NM_014495) Human Mass Spec Standard

CAT#: PH308867

ANGPTL3 MS Standard C13 and N15-labeled recombinant protein (NP_055310)

Product Images

Coomassie blue staining of purified ANGPTL3 protein (Cat# TP308867). The protein was produced from HEK293T cells transfected with ANGPTL3 cDNA clone (Cat# RC208867) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208867
• Predicted MW: 53.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208867 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQIND
  IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKY
  LEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQE
  PTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGS
  PWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFY
  LGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKP
  RAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055310
• RefSeq Size: 2951
• RefSeq ORF: 1380
• Synonyms: ANG-5; ANGPT5; ANL3; FHBL2
• Locus ID: 27329
• UniProt ID: Q9Y5C1
• Cytogenetics: 1p31.3
• Summary: This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metabolism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. [provided by RefSeq, Aug 2015]
• Protein Families: Druggable Genome, Secreted Protein