Cathelicidin (CAMP) (NM_004345) Human Mass Spec Standard
CAT#: PH308872
CAMP MS Standard C13 and N15-labeled recombinant protein (NP_004336)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208872 |
Predicted MW | 19.3 kDa |
Protein Sequence |
>RC208872 protein sequence
Red=Cloning site Green=Tags(s) MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGD PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFR KSKEKIGKEFKRIVQRIKDFLRNLVPRTES myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004336 |
RefSeq Size | 758 |
RefSeq ORF | 510 |
Synonyms | CAP-18; CAP18; CRAMP; FALL-39; FALL39; HSD26; LL37 |
Locus ID | 820 |
UniProt ID | P49913, J3KNB4, A0A384NPR0 |
Cytogenetics | 3p21.31 |
Summary | 'This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014]' |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401385 | CAMP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401385 | Transient overexpression lysate of cathelicidin antimicrobial peptide (CAMP) |
USD 325.00 |
|
TP308872 | Recombinant protein of human cathelicidin antimicrobial peptide (CAMP) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review