Angiogenin (ANG) (NM_001145) Human Mass Spec Standard
CAT#: PH308874
ANG MS Standard C13 and N15-labeled recombinant protein (NP_001136)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208874 |
| Predicted MW | 16.6 kDa |
| Protein Sequence |
>RC208874 protein sequence
Red=Cloning site Green=Tags(s) MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFI HGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLD QSIFRRP myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001136 |
| RefSeq Size | 1222 |
| RefSeq ORF | 441 |
| Synonyms | ALS9; HEL168; RAA1; RNASE4; RNASE5 |
| Locus ID | 283 |
| UniProt ID | P03950, W0UV28 |
| Cytogenetics | 14q11.2 |
| Summary | 'The protein encoded by this gene is a member of the RNase A superfamily though it has relatively weak ribonucleolytic activity. This protein is a potent mediator of new blood vessel formation and thus, in addition to the name RNase5, is commonly called angiogenin. This protein induces angiogenesis after binding to actin on the surface of endothelial cells. This protein also accumulates at the nucleolus where it stimulates ribosomal transcription. Under stress conditions this protein translocates to the cytosol where it hydrolyzes cellular tRNAs and influences protein synthesis. A signal peptide is cleaved from the precursor protein to produce a mature protein which contains a nuclear localization signal, a cell binding motif, and a catalytic domain. This protein has been shown to be both neurotrophic and neuroprotective and the mature protein has antimicrobial activity against some bacteria and fungi, including S. pneumoniae and C. albicans. Due to its effect on rRNA production and angiogenesis this gene plays important roles in cell growth and tumor progression. Mutations in this gene are associated with progression of amyotrophic lateral sclerosis (ALS). This gene and the neighboring RNase4 gene share promoters and 5' exons though each gene then splices to a distinct 3' exon containing the complete coding region of each gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2020]' |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420108 | ANG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC420124 | ANG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425988 | ANG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY420108 | Transient overexpression lysate of angiogenin, ribonuclease, RNase A family, 5 (ANG), transcript variant 1 |
USD 436.00 |
|
| LY420124 | Transient overexpression lysate of angiogenin, ribonuclease, RNase A family, 5 (ANG), transcript variant 2 |
USD 436.00 |
|
| LY425988 | Transient overexpression lysate of angiogenin, ribonuclease, RNase A family, 5 (ANG), transcript variant 2 |
USD 396.00 |
|
| TP308874 | Recombinant protein of human angiogenin, ribonuclease, RNase A family, 5 (ANG), transcript variant 1 |
USD 823.00 |
|
| TP720180 | Recombinant protein of human angiogenin, ribonuclease, RNase A family, 5 (ANG), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China