FXYD4 (NM_173160) Human Mass Spec Standard

CAT#: PH308892

FXYD4 MS Standard C13 and N15-labeled recombinant protein (NP_775183)

Product Images

Coomassie blue staining of purified FXYD4 protein (Cat# TP308892). The protein was produced from HEK293T cells transfected with FXYD4 cDNA clone (Cat# RC208892) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208892
• Predicted MW: 9.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208892 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQH
  SPVPEKAIPLITPGSATTC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_775183
• RefSeq Size: 787
• RefSeq ORF: 267
• Synonyms: CHIF
• Locus ID: 53828
• UniProt ID: P59646
• Cytogenetics: 10q11.21
• Summary: This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found. [provided by RefSeq, May 2010]
• Protein Families: Ion Channels: Other, Transmembrane