Adenine Nucleotide Translocator 2 (SLC25A5) (NM_001152) Human Mass Spec Standard

CAT#: PH308949

SLC25A5 MS Standard C13 and N15-labeled recombinant protein (NP_001143)

Product Images

Coomassie blue staining of purified SLC25A5 protein (Cat# TP308949). The protein was produced from HEK293T cells transfected with SLC25A5 cDNA clone (Cat# RC208949) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208949
• Predicted MW: 32.9 kDa
• Protein Sequence:
  Sequence Link

  >RC208949 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSF
  WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR
  LAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHI
  VISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLR
  GMGGAFVLVLYDEIKKYT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001143
• RefSeq Size: 1351
• RefSeq ORF: 894
• Synonyms: 2F1; AAC2; ANT2; T2; T3
• Locus ID: 292
• UniProt ID: P05141, Q6NVC0
• Cytogenetics: Xq24
• Summary: 'This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Suppressed expression of this gene has been shown to induce apoptosis and inhibit tumor growth. The human genome contains several non-transcribed pseudogenes of this gene.[provided by RefSeq, Jun 2013]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Calcium signaling pathway, Huntington's disease, Parkinson's disease