WDR92 (NM_138458) Human Mass Spec Standard

CAT#: PH308985

WDR92 MS Standard C13 and N15-labeled recombinant protein (NP_612467)

Product Images

Coomassie blue staining of purified WDR92 protein (Cat# TP308985). The protein was produced from HEK293T cells transfected with WDR92 cDNA clone (Cat# RC208985) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208985
• Predicted MW: 39.7 kDa
• Protein Sequence:
  Sequence Link

  >RC208985 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKC
  GTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGT
  VKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKN
  GVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGG
  AGGLHLWKYEYPIQRSKKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLI
  VTKLNKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612467
• RefSeq Size: 2280
• RefSeq ORF: 1071
• Synonyms: FLJ31741
• Locus ID: 116143
• UniProt ID: Q96MX6, A0A140VK67
• Cytogenetics: 2p14
• Summary: This gene encodes a protein with two WD40 repeat domains thought to be involved in an apoptosis via activation of caspase-3. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
• Protein Families: Druggable Genome