JMJD6 (NM_015167) Human Mass Spec Standard
CAT#: PH308993
JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_055982)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208993 |
Predicted MW | 46.5 kDa |
Protein Sequence |
>RC208993 protein sequence
Red=Cloning site Green=Tags(s) MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055982 |
RefSeq Size | 1834 |
RefSeq ORF | 1209 |
Synonyms | PSR; PTDSR; PTDSR1 |
Locus ID | 23210 |
UniProt ID | Q6NYC1 |
Cytogenetics | 17q25.1 |
Summary | This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414758 | JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421156 | JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414758 | Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2 |
USD 396.00 |
|
LY421156 | Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 1 |
USD 396.00 |
|
PH318163 | JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_001074930) |
USD 2,055.00 |
|
TP308993 | Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2 |
USD 823.00 |
|
TP318163 | Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review