ATP6V0D2 (NM_152565) Human Mass Spec Standard

CAT#: PH309007

ATP6V0D2 MS Standard C13 and N15-labeled recombinant protein (NP_689778)

Product Images

Coomassie blue staining of purified ATP6V0D2 protein (Cat# TP309007). The protein was produced from HEK293T cells transfected with ATP6V0D2 cDNA clone (Cat# RC209007) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209007
• Predicted MW: 40.4 kDa
• Protein Sequence:
  Sequence Link

  >RC209007 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLEGAELYFNVDHGYLEGLVRGCKASLLTQQDYINLVQCETLEDLKIHLQTTDYGNFLANHTNPLTVSKI
  DTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDNVILLMNGALQKKSVKEILGKCHPLGRFTEMEA
  VNIAETPSDLFNAILIETPLAPFFQDCMSENALDELNIELLRNKLYKSYLEAFYKFCKNHGDVTAEVMCP
  ILEFEADRRAFIITLNSFGTELSKEDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEA
  VGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689778
• RefSeq Size: 2370
• RefSeq ORF: 1050
• Synonyms: ATP6D2; VMA6
• Locus ID: 245972
• UniProt ID: Q8N8Y2, A0A024R991
• Cytogenetics: 8q21.3
• Summary: Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. [UniProtKB/Swiss-Prot Function]
• Protein Pathways: Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection