Josephin 2 (JOSD2) (NM_138334) Human Mass Spec Standard
CAT#: PH309025
JOSD2 MS Standard C13 and N15-labeled recombinant protein (NP_612207)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209025 |
Predicted MW | 20.8 kDa |
Protein Sequence |
>RC209025 protein sequence
Red=Cloning site Green=Tags(s) MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDV NVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLD SKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_612207 |
RefSeq Size | 863 |
RefSeq ORF | 564 |
Synonyms | SBBI54 |
Locus ID | 126119 |
UniProt ID | Q8TAC2, A0A024R4G2 |
Cytogenetics | 19q13.33 |
Summary | This gene encodes a protein containing a Josephin domain. Josephin domain-containing proteins are deubiquitinating enzymes which catalyze the hydrolysis of the bond between the C-terminal glycine of the ubiquitin peptide and protein substrates. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408621 | JOSD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408621 | Transient overexpression lysate of Josephin domain containing 2 (JOSD2) |
USD 396.00 |
|
TP309025 | Recombinant protein of human Josephin domain containing 2 (JOSD2) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review