Antibodies

Jump to Filters
View as table Download
Josephin 2 (JOSD2) (N-term) Rabbit Polyclonal Antibody
AP52274PU-N

USD 450.00

2 Weeks

Josephin 2 (JOSD2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide from the N-terminal region of Human Josephin-2
Josephin 2 (JOSD2) Rabbit Polyclonal Antibody
TA340284

USD 375.00

5 Days

Rabbit Polyclonal Anti-JOSD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JOSD2 antibody: synthetic peptide directed towards the N terminal of human JOSD2. Synthetic peptide located within the following region: QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA