Josephin 2 (JOSD2) Rabbit Polyclonal Antibody

CAT#: TA340284

Rabbit Polyclonal Anti-JOSD2 Antibody

Product Images

WB Suggested Anti-JOSD2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-JOSD2 antibody: synthetic peptide directed towards the N terminal of human JOSD2. Synthetic peptide located within the following region: QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: Josephin domain containing 2
• Database Link:
  NP_612207
  Entrez Gene 126119 Human
  UniProt ID Q8TAC2
• Background: The specific function of JOSD2 is not yet known.
• Synonyms: SBBI54
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome