Estrogen Related Receptor alpha (ESRRA) (NM_004451) Human Mass Spec Standard

CAT#: PH309028

ESRRA MS Standard C13 and N15-labeled recombinant protein (NP_004442)

Product Images

Coomassie blue staining of purified ESRRA protein (Cat# TP309028). The protein was produced from HEK293T cells transfected with ESRRA cDNA clone (Cat# RC209028) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209028
• Predicted MW: 45.5 kDa
• Protein Sequence:
  Sequence Link

  >RC209028 representing NM_004451
  Red=Cloning site Green=Tags(s)
  
  MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLV
  LSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCL
  RVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLY
  AMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPL
  QDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQ
  LREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
  MMD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004442
• RefSeq Size: 2284
• RefSeq ORF: 1269
• Synonyms: ERR1; ERRa; ERRalpha; ESRL1; NR3B1
• Locus ID: 2101
• UniProt ID: P11474, Q569H8
• Cytogenetics: 11q13.1
• Summary: 'The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate the expression of most genes involved in cellular energy production as well as in the process of mitochondrial biogenesis. A processed pseudogene of ESRRA is located on chromosome 13q12.1. [provided by RefSeq, Jun 2019]'
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors