Chymotrypsin like protease (CTRL) (NM_001907) Human Mass Spec Standard

CAT#: PH309072

CTRL MS Standard C13 and N15-labeled recombinant protein (NP_001898)

Product Images

Coomassie blue staining of purified CTRL protein (Cat# TP309072). The protein was produced from HEK293T cells transfected with CTRL cDNA clone (Cat# RC209072) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209072
• Predicted MW: 28 kDa
• Protein Sequence:
  Sequence Link

  >RC209072 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWV
  VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPV
  CLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSC
  QGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001898
• RefSeq Size: 1197
• RefSeq ORF: 792
• Synonyms: CTRL1
• Locus ID: 1506
• UniProt ID: P40313, A0A024R6Z5
• Cytogenetics: 16q22.1
• Summary: 'This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016]'
• Protein Families: Druggable Genome, Protease