BACE1 (NM_012104) Human Mass Spec Standard
CAT#: PH309115
BACE1 MS Standard C13 and N15-labeled recombinant protein (NP_036236)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209115 |
Predicted MW | 55.8 kDa |
Protein Sequence |
>RC209115 protein sequence
Red=Cloning site Green=Tags(s) MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGK SGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGE LGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNL FSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKE YNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMG EVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQH DDFADDISLLK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036236 |
RefSeq Size | 5864 |
RefSeq ORF | 1503 |
Synonyms | ASP2; BACE; HSPC104 |
Locus ID | 23621 |
UniProt ID | P56817, A0A024R3D7 |
Cytogenetics | 11q23.3 |
Summary | This gene encodes a member of the peptidase A1 family of aspartic proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protease. This transmembrane protease catalyzes the first step in the formation of amyloid beta peptide from amyloid precursor protein. Amyloid beta peptides are the main constituent of amyloid beta plaques, which accumulate in the brains of human Alzheimer's disease patients. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Protein Pathways | Alzheimer's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402147 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408446 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC408448 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC430074 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430076 | BACE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402147 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a |
USD 396.00 |
|
LY408446 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c |
USD 605.00 |
|
LY408448 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d |
USD 605.00 |
|
LY430074 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c |
USD 396.00 |
|
LY430076 | Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d |
USD 396.00 |
|
TP309115 | Recombinant protein of human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review