FOXL2 (NM_023067) Human Mass Spec Standard

CAT#: PH309127

FOXL2 MS Standard C13 and N15-labeled recombinant protein (NP_075555)

Product Images

Coomassie blue staining of purified FOXL2 protein (Cat# TP309127). The protein was produced from HEK293T cells transfected with FOXL2 cDNA clone (Cat# RC209127) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209127
• Predicted MW: 38.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209127 representing NM_023067
  Red=Cloning site Green=Tags(s)
  
  MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPDPAQKPPYSYVALIAMAIRES
  AEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEK
  GNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVAGAGADGYGYLAPPKYLQSGFLNNSWPLPQPP
  SPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYTRVQSMALPPGVVNSYNGLGGP
  PAAPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPGQLSPASPATAAPPAPAPTSAPGLQFACARQ
  PELAMMHCSYWDHDSKTGALHSRLDL
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_075555
• RefSeq Size: 2744
• RefSeq ORF: 1128
• Synonyms: BPES; BPES1; PFRK; PINTO; POF3
• Locus ID: 668
• UniProt ID: P58012, Q53ZD3
• Cytogenetics: 3q22.3
• Summary: This gene encodes a forkhead transcription factor. The protein contains a fork-head DNA-binding domain and may play a role in ovarian development and function. Expansion of a polyalanine repeat region and other mutations in this gene are a cause of blepharophimosis syndrome and premature ovarian failure 3. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome, Transcription Factors