ANKRD16 (NM_019046) Human Mass Spec Standard
CAT#: PH309157
ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_061919)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209157 |
Predicted MW | 39.3 kDa |
Protein Sequence |
>RC209157 protein sequence
Red=Cloning site Green=Tags(s) MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRD YKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNS FHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALM DAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHY AAKEGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRAD VLQGSGHSAMT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061919 |
RefSeq Size | 2646 |
RefSeq ORF | 1083 |
Synonyms | ankyrin repeat domain 16; OTTHUMP00000019019; OTTHUMP00000044872 |
Locus ID | 54522 |
UniProt ID | Q6P6B7 |
Cytogenetics | 10p15.1 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412786 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423159 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423160 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423161 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412786 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 1 |
USD 396.00 |
|
LY423159 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 2 |
USD 396.00 |
|
LY423160 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 3 |
USD 396.00 |
|
LY423161 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 4 |
USD 396.00 |
|
PH315131 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009941) |
USD 2,055.00 |
|
PH322437 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009942) |
USD 2,055.00 |
|
TP309157 | Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 1 |
USD 823.00 |
|
TP315131 | Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 2 |
USD 748.00 |
|
TP322437 | Purified recombinant protein of Homo sapiens ankyrin repeat domain 16 (ANKRD16), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review