SLC30A7 (NM_133496) Human Mass Spec Standard

CAT#: PH309198

SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_598003)

Product Images

Coomassie blue staining of purified SLC30A7 protein (Cat# TP309198). The protein was produced from HEK293T cells transfected with SLC30A7 cDNA clone (Cat# RC209198) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209198
• Predicted MW: 41.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209198 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH
  MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER
  LLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAH
  GHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVV
  SVIPLLRESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARW
  ILSQTHNIFTQAGVRQLYVQIDFAAM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_598003
• RefSeq Size: 8232
• RefSeq ORF: 1128
• Synonyms: ZnT-7; ZNT7; ZnTL2
• Locus ID: 148867
• UniProt ID: Q8NEW0
• Cytogenetics: 1p21.2
• Summary: Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such as SLC30A7, permit cellular efflux of zinc (Seve et al., 2004 [PubMed 15154973]). [supplied by OMIM, Mar 2008]
• Protein Families: Transmembrane