TRIB1 (NM_025195) Human Mass Spec Standard

CAT#: PH309219

TRIB1 MS Standard C13 and N15-labeled recombinant protein (NP_079471)

Product Images

Coomassie blue staining of purified TRIB1 protein (Cat# TP309219). The protein was produced from HEK293T cells transfected with TRIB1 cDNA clone (Cat# RC209219) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209219
• Predicted MW: 41 kDa
• Protein Sequence:
  Sequence Link

  >RC209219 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQ
  PPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSH
  SNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK
  FVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVG
  RYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSE
  IGTSDQIVPEYQEDSDISSFFC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079471
• RefSeq Size: 3649
• RefSeq ORF: 1116
• Synonyms: C8FW; GIG-2; GIG2; SKIP1; TRB-1; TRB1
• Locus ID: 10221
• UniProt ID: Q96RU8
• Cytogenetics: 8q24.13
• Summary: Adapter protein involved in protein degradation by interacting with RFWD2/COP1 ubiquitin ligase (PubMed:27041596). The RFWD2-binding motif is masked by autoinhibitory interactions with the protein kinase domain (PubMed:26455797). Serves to alter RFWD2 substrate specificity by directing the activity of RFWD2 toward CEBPA (PubMed:27041596). Binds selectively the recognition sequence of CEBPA (PubMed:26455797). Regulates myeloid cell differentiation by altering the expression of CEBPA in a RFWD2-dependent manner (By similarity). Controls macrophage, eosinophil and neutrophil differentiation via the COP1-binding domain (By similarity). Interacts with MAPK kinases and regulates activation of MAP kinases, but has no kinase activity (PubMed:15299019, PubMed:26455797). [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Protein Kinase