TRIB1 (NM_025195) Human Mass Spec Standard
CAT#: PH309219
TRIB1 MS Standard C13 and N15-labeled recombinant protein (NP_079471)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209219 |
Predicted MW | 41 kDa |
Protein Sequence |
>RC209219 protein sequence
Red=Cloning site Green=Tags(s) MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQ PPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSH SNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK FVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVG RYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSE IGTSDQIVPEYQEDSDISSFFC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079471 |
RefSeq Size | 3649 |
RefSeq ORF | 1116 |
Synonyms | C8FW; GIG-2; GIG2; SKIP1; TRB-1; TRB1 |
Locus ID | 10221 |
UniProt ID | Q96RU8 |
Cytogenetics | 8q24.13 |
Summary | Adapter protein involved in protein degradation by interacting with RFWD2/COP1 ubiquitin ligase (PubMed:27041596). The RFWD2-binding motif is masked by autoinhibitory interactions with the protein kinase domain (PubMed:26455797). Serves to alter RFWD2 substrate specificity by directing the activity of RFWD2 toward CEBPA (PubMed:27041596). Binds selectively the recognition sequence of CEBPA (PubMed:26455797). Regulates myeloid cell differentiation by altering the expression of CEBPA in a RFWD2-dependent manner (By similarity). Controls macrophage, eosinophil and neutrophil differentiation via the COP1-binding domain (By similarity). Interacts with MAPK kinases and regulates activation of MAP kinases, but has no kinase activity (PubMed:15299019, PubMed:26455797). [UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410846 | TRIB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410846 | Transient overexpression lysate of tribbles homolog 1 (Drosophila) (TRIB1) |
USD 396.00 |
|
TP309219 | Recombinant protein of human tribbles homolog 1 (Drosophila) (TRIB1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review