IRAKM (IRAK3) (NM_007199) Human Mass Spec Standard

CAT#: PH309245

IRAK3 MS Standard C13 and N15-labeled recombinant protein (NP_009130)

Product Images

Coomassie blue staining of purified IRAK3 protein (Cat# TP309245). The protein was produced from HEK293T cells transfected with IRAK3 cDNA clone (Cat# RC209245) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209245
• Predicted MW: 67.8 kDa
• Protein Sequence:
  Sequence Link

  >RC209245 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEKYVDQGKSGTR
  ELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIP
  EHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQCKKHWKRFL
  SELEVLLLFHHPNILELAAYFTETEKFCLIYPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHY
  LHNVQPCSVICGSISSANILLDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGK
  LSIKTDVYSFGIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
  LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
  PSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVN
  IDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009130
• RefSeq Size: 8351
• RefSeq ORF: 1788
• Synonyms: ASRT5; IRAKM
• Locus ID: 11213
• UniProt ID: Q9Y616
• Cytogenetics: 12q14.3
• Summary: This gene encodes a member of the interleukin-1 receptor-associated kinase protein family. Members of this family are essential components of the Toll/IL-R immune signal transduction pathways. This protein is primarily expressed in monocytes and macrophages and functions as a negative regulator of Toll-like receptor signaling. Mutations in this gene are associated with a susceptibility to asthma. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Apoptosis, Neurotrophin signaling pathway