Vitamin D Receptor (VDR) (NM_000376) Human Mass Spec Standard
CAT#: PH309262
VDR MS Standard C13 and N15-labeled recombinant protein (NP_000367)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209262 |
| Predicted MW | 48.3 kDa |
| Protein Sequence |
>RC209262 protein sequence
Red=Cloning site Green=Tags(s) MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITK DNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHH KTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEE DSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFT MDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAA LIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE VFGNEIS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000367 |
| RefSeq Size | 4669 |
| RefSeq ORF | 1281 |
| Synonyms | NR1I1; PPP1R163 |
| Locus ID | 7421 |
| UniProt ID | P11473, F1D8P8 |
| Cytogenetics | 12q13.11 |
| Summary | 'This gene encodes vitamin D3 receptor, which is a member of the nuclear hormone receptor superfamily of ligand-inducible transcription factors. This receptor also functions as a receptor for the secondary bile acid, lithocholic acid. Downstream targets of vitamin D3 receptor are principally involved in mineral metabolism, though this receptor regulates a variety of other metabolic pathways, such as those involved in immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Jun 2018]' |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422745 | VDR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC424760 | VDR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LC425408 | VDR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY422745 | Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2 |
USD 665.00 |
|
| LY424760 | Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1 |
USD 436.00 |
|
| LY425408 | Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2 |
USD 396.00 |
|
| PH319628 | VDR MS Standard C13 and N15-labeled recombinant protein (NP_001017535) |
USD 2,055.00 |
|
| TP309262 | Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1 |
USD 867.00 |
|
| TP319628 | Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China