Factor D (CFD) (NM_001928) Human Mass Spec Standard

CAT#: PH309272

CFD MS Standard C13 and N15-labeled recombinant protein (NP_001919)

Product Images

Coomassie blue staining of purified CFD protein (Cat# TP309272). The protein was produced from HEK293T cells transfected with CFD cDNA clone (Cat# RC209272) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209272
• Predicted MW: 27 kDa
• Protein Sequence:
  Sequence Link

  >RC209272 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLED
  AADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDR
  DVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGG
  PLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001919
• RefSeq Size: 1173
• RefSeq ORF: 759
• Synonyms: ADIPSIN; ADN; DF; PFD
• Locus ID: 1675
• UniProt ID: P00746
• Cytogenetics: 19p13.3
• Summary: This gene encodes a member of the S1, or chymotrypsin, family of serine peptidases. This protease catalyzes the cleavage of factor B, the rate-limiting step of the alternative pathway of complement activation. This protein also functions as an adipokine, a cell signaling protein secreted by adipocytes, which regulates insulin secretion in mice. Mutations in this gene underlie complement factor D deficiency, which is associated with recurrent bacterial meningitis infections in human patients. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the mature protease. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome, Protease, Secreted Protein
• Protein Pathways: Complement and coagulation cascades