BACH1 (NM_001186) Human Mass Spec Standard
CAT#: PH309275
BACH1 MS Standard C13 and N15-labeled recombinant protein (NP_001177)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209275 |
Predicted MW | 82 kDa |
Protein Sequence |
>RC209275 protein sequence
Red=Cloning site Green=Tags(s) MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGE LNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLKFKFLDSTADQQEC PRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRYQGNAKASPPLQDSASQTYESM CLEKDAALALPSLCPKYRKFQKAFGTDRVRTGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCD ESKLAMEPEETKKDPASQCPTEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKP LSGTDVQEKTFGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQE PCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRNDFQSLLKMHKLTPEQLDCIHD IRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLLKERDHILSTLGETKQNLTGLCQKVCKEAAL SQEQIQILAKYSAADCPLSFLISEKDKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQ MSTATSEQAGPAEQCRQSGGISDFCQQMTDKCTTDE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001177 |
RefSeq Size | 5642 |
RefSeq ORF | 2208 |
Synonyms | BACH-1; BTBD24 |
Locus ID | 571 |
UniProt ID | O14867 |
Cytogenetics | 21q21.3 |
Summary | 'This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, May 2009]' |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400475 | BACH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404144 | BACH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY400475 | Transient overexpression lysate of BTB and CNC homology 1, basic leucine zipper transcription factor 1 (BACH1), transcript variant 2 |
USD 396.00 |
|
LY404144 | Transient overexpression lysate of BTB and CNC homology 1, basic leucine zipper transcription factor 1 (BACH1), transcript variant 1 |
USD 605.00 |
|
PH321628 | BACH1 MS Standard C13 and N15-labeled recombinant protein (NP_996749) |
USD 2,055.00 |
|
TP309275 | Recombinant protein of human BTB and CNC homology 1, basic leucine zipper transcription factor 1 (BACH1), transcript variant 2 |
USD 867.00 |
|
TP321628 | Recombinant protein of human BTB and CNC homology 1, basic leucine zipper transcription factor 1 (BACH1), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review