TUBA3D (NM_080386) Human Mass Spec Standard

CAT#: PH309276

TUBA3D MS Standard C13 and N15-labeled recombinant protein (NP_525125)

Product Images

Coomassie blue staining of purified TUBA3D protein (Cat# TP309276). The protein was produced from HEK293T cells transfected with TUBA3D cDNA clone (Cat# RC209276) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209276
• Predicted MW: 50 kDa
• Protein Sequence:
  Sequence Link

  >RC209276 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL
  EPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHS
  FGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY
  DICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK
  AYHEQLSVAEITNACFEPANQMVKYDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG
  FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
  AREDLAALEKDYEEVGVDSVEAEAEEGEEY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_525125
• RefSeq Size: 1646
• RefSeq ORF: 1350
• Synonyms: H2-ALPHA; KTCN9; TUBA2
• Locus ID: 113457
• UniProt ID: P0DPH7, P0DPH8, Q1ZYQ1
• Cytogenetics: 2q21.1
• Summary: This gene encodes a member of the alpha tubulin family. Tubulin is a major component of microtubules, which are composed of alpha- and beta-tubulin heterodimers and microtubule-associated proteins in the cytoskeleton. Microtubules maintain cellular structure, function in intracellular transport, and play a role in spindle formation during mitosis. [provided by RefSeq, Oct 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Gap junction, Pathogenic Escherichia coli infection