CNOT7 (NM_013354) Human Mass Spec Standard

CAT#: PH309293

CNOT7 MS Standard C13 and N15-labeled recombinant protein (NP_037486)

Product Images

Coomassie blue staining of purified CNOT7 protein (Cat# TP309293). The protein was produced from HEK293T cells transfected with CNOT7 cDNA clone (Cat# RC209293) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209293
• Predicted MW: 32.7 kDa
• Protein Sequence:
  Sequence Link

  >RC209293 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD
  LLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELL
  MTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQ
  EVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEE
  ANKQS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037486
• RefSeq Size: 2646
• RefSeq ORF: 855
• Synonyms: CAF-1; CAF1; Caf1a; hCAF-1
• Locus ID: 29883
• UniProt ID: Q9UIV1, Q96IQ6
• Cytogenetics: 8p22
• Summary: The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The encoded protein downregulates the innate immune response and therefore provides a therapeutic target for enhancing its antimicrobial activity against foreign agents. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Apr 2016]
• Protein Families: Transcription Factors
• Protein Pathways: RNA degradation