C6orf58 (NM_001010905) Human Mass Spec Standard

CAT#: PH309372

C6orf58 MS Standard C13 and N15-labeled recombinant protein (NP_001010905)

Product Images

Coomassie blue staining of purified C6orf58 protein (Cat# TP309372). The protein was produced from HEK293T cells transfected with C6orf58 cDNA clone (Cat# RC209372) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209372
• Predicted MW: 37.9 kDa
• Protein Sequence:
  Sequence Link

  >RC209372 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAFLPSWVCVLVGSFSASLAGTSNLSETEPPLWKESPGQLSDYRVENSMYIINPWVYLERMGMYKIILNQ
  TARYFAKFAPDNEQNILWGLPLQYGWQYRTGRLADPTRRTNCGYESGDHMCISVDSWWADLNYFLSSLPF
  LAAVDSGVMGISSDQVRLLPPPKNERKFCYDVSSCRSSFPETMNKWNTFYQYLQSPFSKFDDLLKYLWAA
  HTSTLADNIKSFEDRYDYYSKAEAHFERSWVLAVDHLAAVLFPTTLIRSYKFQKGMPPRILLNTDVAPFI
  SDFTAFQNVVLVLLNMLDNVDKSIGYLCTEKSNVYRDHSESSSRSYGNNS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001010905
• RefSeq Size: 1201
• RefSeq ORF: 990
• Synonyms: LEG1
• Locus ID: 352999
• UniProt ID: Q6P5S2
• Cytogenetics: 6q22.33
• Protein Families: Secreted Protein