BANF2 (NM_178477) Human Mass Spec Standard
CAT#: PH309388
BANF2 MS Standard C13 and N15-labeled recombinant protein (NP_848572)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209388 |
Predicted MW | 10.3 kDa |
Protein Sequence |
>RC209388 protein sequence
Red=Cloning site Green=Tags(s) MDDMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEFQRWLICCFGA TECEAQQTSHCLKEWCACFL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_848572 |
RefSeq Size | 629 |
RefSeq ORF | 270 |
Synonyms | BAF-L; BAF2; BAFL; C20orf179 |
Locus ID | 140836 |
UniProt ID | Q9H503, A0A140VK85 |
Cytogenetics | 20p12.1 |
Summary | May play a role in BANF1 regulation and influence tissue-specific roles of BANF1. [UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405884 | BANF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423098 | BANF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425375 | BANF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405884 | Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 1 |
USD 396.00 |
|
LY423098 | Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 2 |
USD 396.00 |
|
LY425375 | Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 2 |
USD 396.00 |
|
PH308893 | BANF2 MS Standard C13 and N15-labeled recombinant protein (NP_001014977) |
USD 2,055.00 |
|
TP308893 | Recombinant protein of human barrier to autointegration factor 2 (BANF2), transcript variant 2 |
USD 823.00 |
|
TP309388 | Recombinant protein of human barrier to autointegration factor 2 (BANF2), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review