BANF2 (NM_001014977) Human Recombinant Protein
CAT#: TP308893
Recombinant protein of human barrier to autointegration factor 2 (BANF2), transcript variant 2
View other "BANF2" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208893 protein sequence
Red=Cloning site Green=Tags(s) MDDMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEFQRWLICCFGA TECEAQQTSHCLKEWCACFL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001014977 |
Locus ID | 140836 |
UniProt ID | Q9H503, A0A140VK85 |
Cytogenetics | 20p12.1 |
Refseq Size | 466 |
Refseq ORF | 270 |
Synonyms | BAF-L; BAF2; BAFL; C20orf179 |
Summary | May play a role in BANF1 regulation and influence tissue-specific roles of BANF1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405884 | BANF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423098 | BANF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425375 | BANF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405884 | Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 1 |
USD 396.00 |
|
LY423098 | Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 2 |
USD 396.00 |
|
LY425375 | Transient overexpression lysate of barrier to autointegration factor 2 (BANF2), transcript variant 2 |
USD 396.00 |
|
PH308893 | BANF2 MS Standard C13 and N15-labeled recombinant protein (NP_001014977) |
USD 2,055.00 |
|
PH309388 | BANF2 MS Standard C13 and N15-labeled recombinant protein (NP_848572) |
USD 2,055.00 |
|
TP309388 | Recombinant protein of human barrier to autointegration factor 2 (BANF2), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review