LYPLA3 (PLA2G15) (NM_012320) Human Mass Spec Standard
CAT#: PH309446
PLA2G15 MS Standard C13 and N15-labeled recombinant protein (NP_036452)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209446 |
Predicted MW | 46.7 kDa |
Protein Sequence |
>RC209446 protein sequence
Red=Cloning site Green=Tags(s) MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTE SYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHT MVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQR QPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEK VFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDR DPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036452 |
RefSeq Size | 2764 |
RefSeq ORF | 1236 |
Synonyms | ACS; GXVPLA2; LLPL; LPLA2; LYPLA3 |
Locus ID | 23659 |
UniProt ID | Q8NCC3 |
Cytogenetics | 16q22.1 |
Summary | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Protein Pathways | Glycerophospholipid metabolism, Lysosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415835 | PLA2G15 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415835 | Transient overexpression lysate of phospholipase A2, group XV (PLA2G15) |
USD 396.00 |
|
TP309446 | Recombinant protein of human phospholipase A2, group XV (PLA2G15) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review