DGLUCY (NM_024952) Human Mass Spec Standard
CAT#: PH309454
C14orf159 MS Standard C13 and N15-labeled recombinant protein (NP_079228)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209454 |
Predicted MW | 66.4 kDa |
Protein Sequence |
>RC209454 protein sequence
Red=Cloning site Green=Tags(s) MPFTLHLRSRLPSAIRSLILQKKPNIRNTSSMAGELRPASLVVLPRSLAPAFERFCQVNTGPLPLLGQSE PEKWMLPPQGAISETRMGHPQFWKYEFGACTGSLASLEQYSEQLKDMVAFFLGCSFSLEEALEKAGLPRR DPAGHSQTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAY GDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLAFASIPGCTVMTDLKDAKAPPGCLTPERIPEVHHISQD PLHYSIASVSASQKIRELESMIGIDPGNRGIGHLLCKDELLKASLSLSHARSVLITTGFPTHFNHEPPEE TDGPPGAVALVAFLQALEKEVAIIVDQRAWNLHQKIVEDAVEQGVLKTQIPILTYQGGSVEAAQAFLCKN GDPQTPRFDHLVAIERAGRAADGNYYNARKMNIKHLVDPIDDLFLAAKKIPGISSTGVGDGGNELGMGKV KEAVRRHIRHGDVIACDVEADFAVIAGVSNWGGYALACALYILYSCAVHSQYLRKAVGPSRAPGDQAWTQ ALPSVIKEEKMLGILVQHKVRSGVSGIVGMEVDGLPFHNTHAEMIQKLVDVTTAQV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079228 |
RefSeq Size | 3011 |
RefSeq ORF | 1848 |
Synonyms | C14orf159 |
Locus ID | 80017 |
UniProt ID | Q7Z3D6 |
Cytogenetics | 14q32.11 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410951 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420133 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420134 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420135 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420136 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC426166 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426167 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410951 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 3 |
USD 325.00 |
|
LY420133 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 1 |
USD 495.00 |
|
LY420134 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 2 |
USD 495.00 |
|
LY420135 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 4 |
USD 495.00 |
|
LY420136 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 5 |
USD 495.00 |
|
LY426166 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 1 |
USD 325.00 |
|
LY426167 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 2 |
USD 325.00 |
|
TP309454 | Recombinant protein of human chromosome 14 open reading frame 159 (C14orf159), transcript variant 3 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review