DGLUCY (NM_024952) Human Recombinant Protein
CAT#: TP309454
Recombinant protein of human chromosome 14 open reading frame 159 (C14orf159), transcript variant 3
View other "DGLUCY" proteins (15)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209454 protein sequence
Red=Cloning site Green=Tags(s) MPFTLHLRSRLPSAIRSLILQKKPNIRNTSSMAGELRPASLVVLPRSLAPAFERFCQVNTGPLPLLGQSE PEKWMLPPQGAISETRMGHPQFWKYEFGACTGSLASLEQYSEQLKDMVAFFLGCSFSLEEALEKAGLPRR DPAGHSQTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAY GDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLAFASIPGCTVMTDLKDAKAPPGCLTPERIPEVHHISQD PLHYSIASVSASQKIRELESMIGIDPGNRGIGHLLCKDELLKASLSLSHARSVLITTGFPTHFNHEPPEE TDGPPGAVALVAFLQALEKEVAIIVDQRAWNLHQKIVEDAVEQGVLKTQIPILTYQGGSVEAAQAFLCKN GDPQTPRFDHLVAIERAGRAADGNYYNARKMNIKHLVDPIDDLFLAAKKIPGISSTGVGDGGNELGMGKV KEAVRRHIRHGDVIACDVEADFAVIAGVSNWGGYALACALYILYSCAVHSQYLRKAVGPSRAPGDQAWTQ ALPSVIKEEKMLGILVQHKVRSGVSGIVGMEVDGLPFHNTHAEMIQKLVDVTTAQV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 66.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079228 |
Locus ID | 80017 |
UniProt ID | Q7Z3D6 |
Cytogenetics | 14q32.11 |
Refseq Size | 3011 |
Refseq ORF | 1848 |
Synonyms | C14orf159 |
Summary | D-glutamate cyclase that converts D-glutamate to 5-oxo-D-proline.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410951 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420133 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420134 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420135 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420136 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC426166 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426167 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410951 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 3 |
USD 396.00 |
|
LY420133 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 1 |
USD 605.00 |
|
LY420134 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 2 |
USD 605.00 |
|
LY420135 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 4 |
USD 605.00 |
|
LY420136 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 5 |
USD 605.00 |
|
LY426166 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 1 |
USD 396.00 |
|
LY426167 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 2 |
USD 396.00 |
|
PH309454 | C14orf159 MS Standard C13 and N15-labeled recombinant protein (NP_079228) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review