MASA (ENOPH1) (NM_021204) Human Mass Spec Standard

CAT#: PH309510

ENOPH1 MS Standard C13 and N15-labeled recombinant protein (NP_067027)

Product Images

Coomassie blue staining of purified ENOPH1 protein (Cat# TP309510). The protein was produced from HEK293T cells transfected with ENOPH1 cDNA clone (Cat# RC209510) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209510
• Predicted MW: 28.9 kDa
• Protein Sequence:
  Sequence Link

  >RC209510 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLD
  GAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVR
  KWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFL
  TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067027
• RefSeq Size: 2191
• RefSeq ORF: 783
• Synonyms: E1; MASA; MST145; mtnC
• Locus ID: 58478
• UniProt ID: Q9UHY7
• Cytogenetics: 4q21.22
• Summary: Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). [UniProtKB/Swiss-Prot Function]
• Protein Pathways: Cysteine and methionine metabolism