RAB22A (NM_020673) Human Mass Spec Standard

CAT#: PH309511

RAB22A MS Standard C13 and N15-labeled recombinant protein (NP_065724)

Product Images

Coomassie blue staining of purified RAB22A protein (Cat# TP309511). The protein was produced from HEK293T cells transfected with RAB22A cDNA clone (Cat# RC209511) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209511
• Predicted MW: 21.9 kDa
• Protein Sequence:
  Sequence Link

  >RC209511 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL
  APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI
  HAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065724
• RefSeq Size: 8702
• RefSeq ORF: 582
• Synonyms: MGC16770
• Locus ID: 57403
• UniProt ID: Q9UL26
• Cytogenetics: 20q13.32
• Summary: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis