XAGE2 (NM_130777) Human Mass Spec Standard

CAT#: PH309757

XAGE2 MS Standard C13 and N15-labeled recombinant protein (NP_570133)

Product Images

Coomassie blue staining of purified XAGE2 protein (Cat# TP309757). The protein was produced from HEK293T cells transfected with XAGE2 cDNA clone (Cat# RC209757) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209757
• Predicted MW: 12.4 kDa
• Protein Sequence:
  Sequence Link

  >RC209757 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADL
  QELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_570133
• RefSeq Size: 651
• RefSeq ORF: 333
• Synonyms: CT12.2; GAGED3; XAGE-2; XAGE2B
• Locus ID: 9502
• UniProt ID: Q96GT9, A0A024R2A6
• Cytogenetics: Xp11.22
• Summary: This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq, Jul 2008]