Y14 (RBM8A) (NM_005105) Human Mass Spec Standard

CAT#: PH309770

RBM8A MS Standard C13 and N15-labeled recombinant protein (NP_005096)

Product Images

Coomassie blue staining of purified RBM8A protein (Cat# TP309770). The protein was produced from HEK293T cells transfected with RBM8A cDNA clone (Cat# RC209770) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209770
• Predicted MW: 19.7 kDa
• Protein Sequence:
  Sequence Link

  >RC209770 representing NM_005105
  Red=Cloning site Green=Tags(s)
  
  MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV
  EGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM
  GQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005096
• RefSeq Size: 2787
• RefSeq ORF: 522
• Synonyms: BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
• Locus ID: 9939
• UniProt ID: Q9Y5S9, A0A023T787
• Cytogenetics: 1q21.1
• Summary: This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome