MSC (NM_005098) Human Mass Spec Standard

CAT#: PH309818

MSC MS Standard C13 and N15-labeled recombinant protein (NP_005089)

Product Images

Coomassie blue staining of purified MSC protein (Cat# TP309818). The protein was produced from HEK293T cells transfected with MSC cDNA clone (Cat# RC209818) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209818
• Predicted MW: 22.1 kDa
• Protein Sequence:
  Sequence Link

  >RC209818 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGC
  KRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPD
  TKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRPDSDTKEVSAANRLCGTTA
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005089
• RefSeq Size: 2075
• RefSeq ORF: 618
• Synonyms: ABF-1; ABF1; bHLHa22; MYOR
• Locus ID: 9242
• UniProt ID: O60682
• Cytogenetics: 8q13.3
• Summary: The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors