PSMD14 (NM_005805) Human Mass Spec Standard

CAT#: PH309829

PSMD14 MS Standard C13 and N15-labeled recombinant protein (NP_005796)

Product Images

Coomassie blue staining of purified PSMD14 protein (Cat# TP309829). The protein was produced from HEK293T cells transfected with PSMD14 cDNA clone (Cat# RC209829) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209829
• Predicted MW: 34.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209829 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVI
  DVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERA
  VAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN
  ELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDP
  KRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005796
• RefSeq Size: 1734
• RefSeq ORF: 930
• Synonyms: PAD1; POH1; RPN11
• Locus ID: 10213
• UniProt ID: O00487, A0A140VKF2
• Cytogenetics: 2q24.2
• Summary: This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S proteasome and mediates substrate deubiquitination. A pseudogene of this gene is also located on the long arm of chromosome 2. [provided by RefSeq, Feb 2012]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome