FOXO3 (NM_001455) Human Mass Spec Standard
CAT#: PH309846
FOXO3 MS Standard C13 and N15-labeled recombinant protein (NP_001446)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209846 |
Predicted MW | 71.1 kDa |
Protein Sequence |
>RC209846 representing NM_001455
Red=Cloning site Green=Tags(s) MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGG GRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGA AGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSI RHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSD PLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRS ELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001446 |
RefSeq Size | 3338 |
RefSeq ORF | 2019 |
Synonyms | AF6q21; FKHRL1; FKHRL1P2; FOXO2; FOXO3A |
Locus ID | 2309 |
UniProt ID | O43524 |
Cytogenetics | 6q21 |
Summary | 'This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Chemokine signaling pathway, Endometrial cancer, Neurotrophin signaling pathway, Non-small cell lung cancer |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400566 | FOXO3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404461 | FOXO3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430878 | FOXO3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY400566 | Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 1 |
USD 396.00 |
|
LY404461 | Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 2 |
USD 396.00 |
|
LY430878 | Transient overexpression lysate of forkhead box O3 (FOXO3), transcript variant 2 |
USD 605.00 |
|
PH302894 | FOXO3 MS Standard C13 and N15-labeled recombinant protein (NP_963853) |
USD 2,055.00 |
|
TP302894 | Recombinant protein of human forkhead box O3 (FOXO3), transcript variant 2 |
USD 867.00 |
|
TP309846 | Recombinant protein of human forkhead box O3 (FOXO3), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review