14-3-3 zeta (YWHAZ) (NM_003406) Human Mass Spec Standard

CAT#: PH309909

YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_003397)

Product Images

Coomassie blue staining of purified YWHAZ protein (Cat# TP309909). The protein was produced from HEK293T cells transfected with YWHAZ cDNA clone (Cat# RC209909) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209909
• Predicted MW: 27.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209909 representing NM_003406
  Red=Cloning site Green=Tags(s)
  
  MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE
  GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG
  IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES
  YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003397
• RefSeq Size: 2834
• RefSeq ORF: 735
• Synonyms: 14-3-3-zeta; HEL-S-3; HEL-S-93; HEL4; KCIP-1; POPCHAS; YWHAD
• Locus ID: 7534
• UniProt ID: P63104, D0PNI1
• Cytogenetics: 8q22.3
• Summary: 'This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008]'
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection