DNAJC19 (NM_145261) Human Mass Spec Standard

CAT#: PH309910

DNAJC19 MS Standard C13 and N15-labeled recombinant protein (NP_660304)

Product Images

Coomassie blue staining of purified DNAJC19 protein (Cat# TP309910). The protein was produced from HEK293T cells transfected with DNAJC19 cDNA clone (Cat# RC209910) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209910
• Predicted MW: 12.5 kDa
• Protein Sequence:
  Sequence Link

  >RC209910 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVS
  PTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660304
• RefSeq Size: 1476
• RefSeq ORF: 348
• Synonyms: PAM18; TIM14; TIMM14
• Locus ID: 131118
• UniProt ID: Q96DA6, A0A0S2Z5X1
• Cytogenetics: 3q26.33
• Summary: The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012]
• Protein Families: Transmembrane