DNAJC19 (NM_145261) Human Recombinant Protein

CAT#: TP309910

Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19)

Product Images

Coomassie blue staining of purified DNAJC19 protein (Cat# TP309910). The protein was produced from HEK293T cells transfected with DNAJC19 cDNA clone (Cat# RC209910) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209910 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVS
  PTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_660304
• Locus ID: 131118
• UniProt ID: Q96DA6, A0A0S2Z5X1
• Cytogenetics: 3q26.33
• Refseq Size: 1476
• Refseq ORF: 348
• Synonyms: PAM18; TIM14; TIMM14
• Summary: The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012]
• Protein Families: Transmembrane